.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i8e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A novel family of sequence-specific endoribonucleases associated with the clustered regularly interspaced short palindromic repeats. J.Biol.Chem. 283 20361-20371 2008
    Site MCSG
    PDB Id 2i8e Target Id APC6107
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS5009,AAK41639.1, 273057 Molecular Weight 11935.17 Da.
    Residues 101 Isoelectric Point 7.95
    Sequence mamlylifyditddnlrnrvaeflkkkgldriqysvfmgdlnssrlkdveaglkiignrkklqederff ilivpitenqfrerivigysgsereeksnvvw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.59 Rfree 0.22708
    Matthews' coefficent 1.95 Rfactor 0.18783
    Waters 75 Solvent Content 36.89

    Ligand Information
    Ligands
    Metals IOD (IODIDE) x 4

    Jmol

     
    Google Scholar output for 2i8e
    1. Structural basis for DNase activity of a conserved protein implicated in CRISPR-mediated genome defense
    B Wiedenheft, K Zhou, M Jinek, SM Coyle, W Ma - Structure, 2009 - Elsevier
     
    2. Structure of a CRISPR-associated protein Cas2 from Desulfovibrio vulgaris
    P Samai, P Smith, S Shuman - Acta Crystallographica Section F: , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch