.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i71

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a Conserved hypothetical protein from Sulfolobus solfataricus P2. To be Published
    Site MCSG
    PDB Id 2i71 Target Id APC6294
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS5067,AAK41626.1, 273057 Molecular Weight 42926.74 Da.
    Residues 377 Isoelectric Point 6.12
    Sequence masivfstignpkgyqkvtyeidgekfesnvsvlalrdllkvdktvvilgisvadvynckyadyrscke ciiqnskndlgisesyvvapnvyqkfkgkpdhyftyiyyhslrilekeginevfidtthginymgvlak eaiqlavsayaaksekevkvslynsdpvgkdvsdtvklheieaikisplsglkyvtyqilnkdknffnk ifsdsvnaiprfataldnglfiylsekdsslhlkrleddlskdplltpseneinvvykdmkyalshalf yvisrfsgnvdldtlrhyaetyadkvtraiienevdkiekyqmgserkllgeymkvegkgfdkrilyah gglpyagtyvykekdkvyvtygdkideierqi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.22744
    Matthews' coefficent 1.98 Rfactor 0.18066
    Waters 786 Solvent Content 37.90

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2i71
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. The structure of the CRISPR-associated protein Csa3 provides insight into the regulation of the CRISPR/Cas system
    NG Lintner, KA Frankel, SE Tsutakawa - Journal of Molecular , 2011 - Elsevier
     
    3. Protein secondary structure predict based on the path with the maximum weight
    L Luo, Z Shao - Computing and Intelligent Systems, 2009. ICIS , 2009 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch