The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative acetyltransferase (GNAT family) from Pseudomonas aeruginosa PAO1. TO BE PUBLISHED
    Site MCSG
    PDB Id 2i6c Target Id APC5605
    Related PDB Ids 3kkw 
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4716,AAG08180, 208964 Molecular Weight 17784.47 Da.
    Residues 160 Isoelectric Point 6.90
    Sequence mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgqvlgfanfyq wqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfnanaaglllytqlgyqprai aerhdpdgrrvaliqmdkplep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.18259
    Matthews' coefficent 2.35 Rfactor 0.15476
    Waters 301 Solvent Content 47.56

    Ligand Information
    Ligands SO4 (SULFATE) x 2;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1
    Metals CL (CHLORIDE) x 2


    Google Scholar output for 2i6c
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
    2. Estimating quality of template_based protein models by alignment stability
    H Chen, D Kihara - Proteins: Structure, Function, and , 2008 - Wiley Online Library
    3. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
    4. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
    5. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch