.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i3d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein Atu1826, a putative alpha/beta hydrolase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2i3d Target Id APC5865
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4882,NP_532506.1, 176299 Molecular Weight 25083.28 Da.
    Residues 225 Isoelectric Point 6.60
    Sequence mpevifngpagrlegryqpskeksapiaiilhphpqfggtmnnqivyqlfylfqkrgfttlrfnfrsig rsqgefdhgagelsdaasaldwvqslhpdskscwvagysfgawigmqllmrrpeiegfmsiapqpntyd fsflapcpssgliingdadkvapekdvnglveklktqkgilithrtlpganhffngkvdelmgecedyl drrlngelvpepaakrir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.1742
    Matthews' coefficent 2.03 Rfactor 0.1382
    Waters 515 Solvent Content 39.34

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 5;MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2i3d
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch