.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hxr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of CynR, a transcriptional regulator, both in the presence and absence of sodium azide, its activator ligand. To be Published
    Site MCSG
    PDB Id 2hxr Target Id APC5944
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4950,AAC73441.1, 83333 Molecular Weight 26126.67 Da.
    Residues 237 Isoelectric Point 6.21
    Sequence vwrqyasralqelgagkraihdvadltrgslriavtptftsyfigplmadfyarypsitlqlqemsqek iedmlcrdeldvgiafapvhspeleaipllteslalvvaqhhplavheqvalsrlhdeklvllsaefat reqidhycekaglhpqvvieansisavlelirrtslstllpaaiatqhdglkaislappllertavllr rknswqtaaakaflhmaldkcavvggnesr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.256
    Matthews' coefficent 2.47 Rfactor 0.239
    Waters 348 Solvent Content 50.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hxr
    1. Crystal structure of ArgP from Mycobacterium tuberculosis confirms two distinct conformations of full-length LysR transcriptional regulators and reveals its function in
    X Zhou, Z Lou, S Fu, A Yang, H Shen, Z Li - Journal of molecular , 2010 - Elsevier
     
    2. Full-length structures of BenM and two variants reveal different oligomerization schemes for LysR-type transcriptional regulators
    A Ruangprasert, SH Craven, EL Neidle - Journal of molecular , 2010 - Elsevier
     
    3. The oligomerization of CynR in Escherichia coli
    GS Knapp, JC Hu - Protein science, 2009 - Wiley Online Library
     
    4. Oligomerization of the LysR-type transcriptional regulators in Escherichia coli
    GS Knapp - 2009 - gradworks.umi.com
     
    5. Structural characterization and biophysical studies of BenM, a LysR-type transcriptional regulator in Acinetobacter baylyi ADP1
    A Ruangprasert - 2010 - ugakr-maint.libs.uga.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch