.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hs5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative transcriptional regulator GntR from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2hs5 Target Id APC6050
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4991,RHA05160, 101510 Molecular Weight 25904.50 Da.
    Residues 235 Isoelectric Point 5.36
    Sequence ltssnalrgdahsrlaahrgllertsrttrvagilrdaiidgtfrpgarlsepdicaaldvsrntvrea fqiliedrlvahelnrgvfvrvptaeditelyicrrvvecagvngfdpatgdlsrvaealdladeryav edwtgvgtadihfhsalaslnnsnridelmrsvwnearlvfhvmddahrfhgpyltrnheiydalaagn teaagqllktyledaeaqilgayrpvsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.24851
    Matthews' coefficent 2.97 Rfactor 0.1941
    Waters 88 Solvent Content 58.54

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2hs5
    1. Structure of Thermotoga maritima TM0439: implications for the mechanism of bacterial GntR transcription regulators with Zn2+-binding FCD domains
    M Zheng, DR Cooper, NE Grossoehme - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Crystal structure of Thermotoga maritima TM0439: implications for the mechanism of bacterial GntR transcription regulators with Zn2+-binding FCD domains
    M Zheng - 2009 - escholarship.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch