.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hhg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein RPA3614 from Rhodopseudomonas palustris CGA009. To be published
    Site MCSG
    PDB Id 2hhg Target Id APC6234
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5046,NP_948952.1, 258594 Molecular Weight 14978.33 Da.
    Residues 138 Isoelectric Point 6.73
    Sequence mpqtitrgikamldeanssietlttadaialhksgasdvvivdirdpreierdgkipgsfsctrgmlef widpqspyakpifqedkkfvfycagglrsalaaktaqdmglkpvahieggfgawrdaggpieawapkkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.20 Rfree 0.2082
    Matthews' coefficent 1.88 Rfactor 0.19175
    Waters 168 Solvent Content 34.51

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2hhg
    1. Automated electron_density sampling reveals widespread conformational polymorphism in proteins
    PT Lang, HL Ng, JS Fraser, JE Corn, N Echols - Protein , 2010 - Wiley Online Library
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch