.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h8o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.6A crystal structure of the geranyltransferase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2h8o Target Id APC6139
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5016,NP_533386.1, 176299 Molecular Weight 32494.31 Da.
    Residues 304 Isoelectric Point 6.62
    Sequence mpssrrvrsrccafgitkrfacirpacqrarmdaqmtnfetrlrenaakteallghllsgearadeitr pqnlleamrhgvlnggkrlrpflviesvallggdaeaglhvgaaleclhcyslvhddlpamddddlrrg qptvhrkfdeatailagdslltlafdiiasddnplaaerkaalvislaraagiggmaggqaldlaaekk apdedgiitlqamktgallrfaceagaiiagsnqaerqrlrlfgekiglsfqladdlldltadaatmgk atgkdaargkgtlvalrgeawareklqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.18804
    Matthews' coefficent 1.83 Rfactor 0.16813
    Waters 331 Solvent Content 32.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2h8o

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch