.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gts

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein HP0062 from Helicobacter pylori. To be Published
    Site MCSG
    PDB Id 2gts Target Id APC5595
    Molecular Characteristics
    Source Helicobacter pylori 26695
    Alias Ids TPS4706,NP_206862, 85962 Molecular Weight 10516.13 Da.
    Residues 86 Isoelectric Point 4.84
    Sequence msrvqmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfnefdeaaq eqiawlkerirvleedy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.29686
    Matthews' coefficent 2.51 Rfactor 0.22189
    Waters 30 Solvent Content 50.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gts
    1. Crystal Structure of Hypothetical Protein HP0062 (O24902_HELPY) from Helicobacter pylori at 1.65 Resolution
    SB Jang, AR Kwon, WS Son, SJ Park - Journal of , 2009 - Jpn Biochemical Soc
     
    2. The homodimeric GBS1074 from Streptococcus agalactiae
    A Shukla, M Pallen, M Anthony - Crystallographica Section F , 2010 - scripts.iucr.org
     
    3. Structural Analysis of Hypothetical Proteins from Helicobacter pylori: An Approach to Estimate Functions of Unknown or Hypothetical Proteins
    SJ Park, WS Son, BJ Lee - International Journal of Molecular Sciences, 2012 - mdpi.com
     
    4. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch