.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gmy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hypothetical protein Atu0492 from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2gmy Target Id APC5961
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4957,NP_531195.1, 176299 Molecular Weight 17110.63 Da.
    Residues 153 Isoelectric Point 6.30
    Sequence mktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrhdglseqwi nlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeivkitvaigaintwnriav gfrsqhpveaaakaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.60 Rfree 0.19089
    Matthews' coefficent 2.35 Rfactor 0.16714
    Waters 767 Solvent Content 47.65

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gmy
    1. SISYPHUSstructural alignments for proteins with non-trivial relationships
    A Andreeva, A Prli_, TJP Hubbard - Nucleic acids , 2007 - Oxford Univ Press
     
    2. MrGrid: a portable grid based molecular replacement pipeline
    JW Schmidberger, MA Bate, CF Reboul - PloS one, 2010 - dx.plos.org
     
    3. Disulfide conformation and design at helix N_termini
    S Indu, ST Kumar, S Thakurela, M Gupta - Proteins: Structure, , 2010 - Wiley Online Library
     
    4. Crystal structure of alkyl hydroperoxidase D like protein PA0269 from Pseudomonas aeruginosa: Homology of the AhpD-like structural family
    T Clarke, V Romanov, Y Chirgadze - BMC structural , 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch