.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gfq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of hypothetical protein ph0006 from Pyrococcus horikoshii. To be Published
    Site MCSG
    PDB Id 2gfq Target Id APC5769
    Molecular Characteristics
    Source Pyrococcus horikoshii ot3
    Alias Ids TPS4816,BAA29074.1, 70601 Molecular Weight 30888.79 Da.
    Residues 274 Isoelectric Point 5.79
    Sequence mkvimttkvdkasmnimnklienfgfketeyvfdgnpvykrgdvlilttndemiyydyldreienqlgf kpeiiafasrhsskqklpaltthvtgnwgkamyggkdesfavaipsamklsllkmselndlgwtvcyea thhgptelevpsffieigsseeewindrageiiaetiiyvldnyekgrskfkvalgiggghyapkqtkr alegdlafghilpkyaqpvsrdvmikalnrfgekveaiyvdwkgsrgetrqlakslaqelglefikd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.75 Rfree 0.17904
    Matthews' coefficent 2.46 Rfactor 0.15049
    Waters 1036 Solvent Content 50.01

    Ligand Information
    Ligands SO4 (SULFATE) x 17
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 2gfq
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Cartographie structurale et fonctionnelle de la liaison entre la peptidyl-ARNt hydrolase et son substrat
    G Laurent - 2010 - hal-polytechnique.archives-ouvertes
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch