.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ge3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Probable acetyltransferase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2ge3 Target Id APC6036
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4982,NP_532963.1, 176299 Molecular Weight 19017.68 Da.
    Residues 170 Isoelectric Point 6.29
    Sequence mmalddtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaiadgdv igwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhrielsvhadnaraialye kigfahegrardavsidghyidslnmaiifgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.25 Rfree 0.26079
    Matthews' coefficent 2.43 Rfactor 0.18978
    Waters 375 Solvent Content 49.47

    Ligand Information
    Ligands ACO (ACETYL) x 3
    Metals

    Jmol

     
    Google Scholar output for 2ge3
    1. Structure of a putative acetyltransferase (PA1377) from Pseudomonas aeruginosa
    AM Davies, R Tata, FX Chauviac, BJ Sutton - Section F: Structural , 2008 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch