.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gax

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein Atu0240 from Agrobacteriium tumerfaciencs str. C58. TO BE PUBLISHED
    Site MCSG
    PDB Id 2gax Target Id APC5876
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4892,NP_530946.1, 176299 Molecular Weight 14982.48 Da.
    Residues 135 Isoelectric Point 6.91
    Sequence mfdtkiavilrddlavwqklnvtaflmsgivaqtgeiigepyrdgagnvynplsiqpivvmatdqealr kihqrslerdittslyieemfatghdaanrqvfshfspdtakvvgmalradrkivdkitkgaklha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.28416
    Matthews' coefficent 2.36 Rfactor 0.24747
    Waters 225 Solvent Content 47.82

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2gax

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch