.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g8y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative malate/lactate dehydrogenase from E. coli. To be Published
    Site MCSG
    PDB Id 2g8y Target Id APC5677
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4759,AAC73888.1, 83333 Molecular Weight 38895.07 Da.
    Residues 361 Isoelectric Point 5.95
    Sequence mesghrfdaqtlhsfiqavfrqmgseeqeaklvadhliaanlaghdshgigmipsyvrswsqghlqinh haktvkeagaavtldgdrafgqvaaheamalgiekahqhgiaavalhnshhigrigywaeqcaaagfvs ihfvsvvgipmvapfhgrdsrfgtnpfcvvfprkdnfpllldyatsaiafgktrvawhkgvpvppgcli dvngvpttnpavmqesplgslltfaehkgyalaamceilggalsggktthqetlqtspdailncmttii inpelfgapdcnaqteafaewvkasphdddkpillpgewevntrrerqkqgipldagswqaicdaarqi gmpeetlqafcqqlas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.18622
    Matthews' coefficent 5.02 Rfactor 0.15757
    Waters 877 Solvent Content 75.52

    Ligand Information
    Ligands SO4 (SULFATE) x 8;NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2;EDO (1,2-ETHANEDIOL) x 10;1PE (PENTAETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2g8y

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch