.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g7g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Putative Transcriptional Regulator Rha04620 from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2g7g Target Id APC6039
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4985,RHA04620, 101510 Molecular Weight 22793.41 Da.
    Residues 209 Isoelectric Point 5.84
    Sequence mgrprvarldreriaeaalelvdrdgdfrmpdlarhlnvqvssiyhhakgraavvelvrhrvvreidgs aferlpwdeafsewarsyraafsrhptairllatetvrdpgslsvyhsaaaglrgagfpddhimavita aenfllgaaldaaapevmieadstttddaltralaaaprgperaeqafelglaallagfhhllqecgavqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.24469
    Matthews' coefficent 2.14 Rfactor 0.19074
    Waters 126 Solvent Content 42.63

    Ligand Information
    Ligands ACY (ACETIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 2g7g
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch