.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g39

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of coenzyme A transferase from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2g39 Target Id APC5751
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4802,AAG08830.1, 208964 Molecular Weight 53961.69 Da.
    Residues 497 Isoelectric Point 5.87
    Sequence myrdrvrlpslldkvmsaaeaadliqdgmtvgmsgftrageakavpqalamrakerplrislmtgaslg ndldkqlteagvlarrmpfqvdstlrkainagevmfidqhlsetveqlrnhqlklpdiavieaaaiteq ghivpttsvgnsasfaifakqviveinlahstnleglhdiyiptyrptrtpipltrvddrigstaipip pekivaivindqpdspstvlppdgetqaianhlidffkrevdagrmsnslgplqagigsianavmcgli espfenltmysevlqdstfdlidagklrfasgssitlsprrnadvfgnlerykdklvlrpqeisnhpev vrrlgiigintalefdiygnvnsthvggtkmmngiggsgdfarnahlaifvtksiakggnissvvpmvs hvdhtehdvdilvteqgladlrglaprerarviiencvhpsyqaplldyfeaacakgghtphllreala whlnleerghmlag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.20356
    Matthews' coefficent 3.09 Rfactor 0.16242
    Waters 796 Solvent Content 60.22

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;ACY (ACETIC) x 8
    Metals

    Jmol

     
    Google Scholar output for 2g39
    1. The other 90% of the protein: Assessment beyond the C_s for CASP8 template_based and high_accuracy models
    DA Keedy, CJ Williams, JJ Headd - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     
    3. Systematic analysis of short internal indels and their impact on protein folding
    RG Kim, J Guo - BMC structural biology, 2010 - biomedcentral.com
     
    4. Crystal structure of 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum
    S Macieira, J Zhang, M Velarde, W Buckel - Biological , 2009 - degruyter.com
     
    5. Crystal structure of the complex between 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum and CoA
    S Macieira, J Zhang, W Buckel - Archives of microbiology, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch