.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ftp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of hydroxymethylglutaryl-CoA lyase from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2ftp Target Id APC5763
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4811,AAG05399.1, 208964 Molecular Weight 31835.56 Da.
    Residues 300 Isoelectric Point 5.80
    Sequence mnlpkkvrlvevgprdglqnekqpievadkirlvddlsaagldyievgsfvspkwvpqmagsaevfagi rqrpgvtyaalapnlkgfeaalesgvkevavfaaaseafsqrnincsikdslerfvpvleaarqhqvrv rgyiscvlgcpydgdvdprqvawvarelqqmgcyevslgdtigvgtagatrrlieavasevprerlagh fhdtygqalaniyasllegiavfdssvaglggcpyakgatgnvasedvlyllngleihtgvdmhalvda gqricavlgksngsraakallaka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.21309
    Matthews' coefficent 4.41 Rfactor 0.18713
    Waters 222 Solvent Content 72.12

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2ftp
    1. BMF: Bitmapped Mass Fingerprinting for Fast Protein Identification
    W Yu, KJ Wu, WS Ku, C Xu - (CLUSTER), 2011 IEEE , 2011 - ieeexplore.ieee.org
     
    2. Protein-protein interface: database, analysis and prediction
    F Wu - 2009 - lib.dr.iastate.edu
     
    3. The accurate prediction of disordered regions in protein sequences using machine learning approaches
    P Han - 2012 - researchbank.rmit.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch