.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fsq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Conserved Hypothetical Protein Atu0111 from Agrobacterium tumefaciens str. C58. To be Published
    Site MCSG
    PDB Id 2fsq Target Id APC6011
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4976,NP_530820.1, 176299 Molecular Weight 27408.77 Da.
    Residues 239 Isoelectric Point 5.23
    Sequence mhaplvskdldyistanhdqpprhlgsrfsaegeflpepgntvvchlvegsqtesaivstrqrfldmpe asqlaftpvsslhmtvfqgviesrralpywpqtlpldtpidavtdyyrdrlstfptlpafnmrvtglrp vgmvmkgataeddsivalwrdtfadffgyrhpdhdtyefhitlsyivswfepeclprwqamldeelekl rvaapviqmrppafcefkdmnhfkelvvfdkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.20032
    Matthews' coefficent 2.01 Rfactor 0.15376
    Waters 335 Solvent Content 38.80

    Ligand Information
    Ligands ACY (ACETIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 2fsq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch