.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fiy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the FdhE protein from Pseudomonas aeruginosa PAO1. To be Published
    Site MCSG
    PDB Id 2fiy Target Id APC5764
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4812,AAG08195.1, 208964 Molecular Weight 33860.94 Da.
    Residues 309 Isoelectric Point 5.61
    Sequence msrtilqpgqieaaanipphlhqpsrdlfarrgerllqlaeghpmgdylrlvaglcrlqqalldnppal apldperlrksrehgmpplaydllvregawlpwldallagypapanaavgaaleqlreaeegqrkawai allsgqfdllpaalvpflgaalqvawshwllgleegavvetesrtlcpacgsppmagmirqggketglr ylscslcacewhyvrikcshceeskhlaylslehdgqpaekavlraetcpscqgylkqfylefdrhada laddlaslaldmrlaedgylrrspnlllapgge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.24264
    Matthews' coefficent 2.32 Rfactor 0.19665
    Waters 369 Solvent Content 46.89

    Ligand Information
    Ligands
    Metals FE (FE) x 5

    Jmol

     
    Google Scholar output for 2fiy
    1. Structural analysis of metal sites in proteins: non-heme iron sites as a case study
    C Andreini, I Bertini, G Cavallaro - Journal of molecular , 2009 - Elsevier
     
    2. Conformational changes in redox pairs of protein structures
    SW Fan, RA George, NL Haworth, LL Feng - Protein , 2009 - Wiley Online Library
     
    3. Biosynthesis of the respiratory formate dehydrogenases from Escherichia coli: characterization of the FdhE protein
    I Lke, G Butland, K Moore, G Buchanan, V Lyall - Archives of , 2008 - Springer
     
    4. Colworth Medal Lecture
    F Sargent - Biochemical Society Transactions, 2007 - 212.250.180.38
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch