.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fiw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the GCN5-Related N-acetyltransferase: Aminotransferase, Class-II from Rhodopseudomonas palustris. To be Published 2006
    Site MCSG
    PDB Id 2fiw Target Id APC5959
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS4956,NP_947344.1, 258594 Molecular Weight 17621.70 Da.
    Residues 167 Isoelectric Point 4.47
    Sequence mmstpalrpylpedaavtaaifvasieqltaddyseeqqeawasaaddeakfaarlsgqltliatlqgv pvgfaslkgpdhidmlyvhpdyvgrdvgttlidaleklagargaliltvdasdnaaeffakrgyvakqr ntvsingewlanttmtksladsaapgass
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.26271
    Matthews' coefficent 4.52 Rfactor 0.21899
    Waters 90 Solvent Content 72.76

    Ligand Information
    Ligands SO4 (SULFATE) x 1;ACO (ACETYL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fiw
    1. Solution structure of Apo_YjaB from Escherichia coli
    J Lu, X Wang, B Xia, C Jin - Proteins: Structure, Function, and , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch