The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Acetolactate synthase- small subunit from Thermotoga maritima. To be Published
    Site MCSG
    PDB Id 2fgc Target Id APC4257
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4598,AAD35634, 2336 Molecular Weight 19441.67 Da.
    Residues 171 Isoelectric Point 6.77
    Sequence mtdqirehlvsmlvhnkpgvmrkvanlfarrgfnissitvgesetpglsrlvimvkgddktieqiekqa yklvevvkvtpidplpenrveremalikvrfdedkqeifqlveifrgkiidvsregaiieitgarskve afinllpqkqveeiartgivamnrwnvkegegf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.23643
    Matthews' coefficent 2.45 Rfactor 0.1680
    Waters 41 Solvent Content 49.80

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Metals MG (MAGNESIUM) x 1


    Google Scholar output for 2fgc
    1. Crystal structures of TM0549 and NE1324two orthologs of E. coli AHAS isozyme III small regulatory subunit
    JJ Petkowski, M Chruszcz, MD Zimmerman - Protein , 2007 - Wiley Online Library

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch