.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ffs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of PR10-Allergen-Like Protein PA1206 From Pseudomonas aeruginosa PAO1. To be Published
    Site MCSG
    PDB Id 2ffs Target Id APC5724
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4783,AAG04595.1, 208964 Molecular Weight 17689.17 Da.
    Residues 157 Isoelectric Point 4.62
    Sequence mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlylpglvved evvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqplgdelpydafvkqayiamd vetiatirdrfgasaasgs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.261
    Matthews' coefficent 3.56 Rfactor 0.221
    Waters 37 Solvent Content 65.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ffs
    1. The Bet v 1 fold: an ancient, versatile scaffold for binding of large, hydrophobic ligands
    C Radauer, P Lackner - BMC evolutionary biology, 2008 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch