.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fdr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hydrolases/phosphatases-like fold protein from Agrobacterium tumefaciens str. C58. To be Published
    Site MCSG
    PDB Id 2fdr Target Id APC5770
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4817,NP_531490.1, 176299 Molecular Weight 24903.21 Da.
    Residues 229 Isoelectric Point 5.36
    Sequence msgfdliifdcdgvlvdseiiaaqvesrllteagypisveemgerfagmtwknillqveseasiplsas lldkseklldmrlerdvkiidgvkfalsrlttprcicsnssshrldmmltkvglkpyfaphiysakdlg adrvkpkpdiflhgaaqfgvspdrvvvvedsvhgihgaraagmrvigftgashtypshadrltdagaet visrmqdlpaviaamaewegaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.227
    Matthews' coefficent 1.99 Rfactor 0.174
    Waters 139 Solvent Content 38.35

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2fdr
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Structure of a putative-phosphoglucomutase (TM1254) from Thermotoga maritima
    RW Strange, SV Antonyuk, MJ Ellis - Section F: Structural , 2009 - scripts.iucr.org
     
    3. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch