.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fdo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the AF2331 protein from Archaeoglobus fulgidus DSM 4304 forms an unusual interdigitated dimer with a new type of alpha + beta fold. Protein Sci. 18 2410-2419 2009
    Site MCSG
    PDB Id 2fdo Target Id APC5771
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4818,AAB88923.1, 224325 Molecular Weight 10520.36 Da.
    Residues 92 Isoelectric Point 4.30
    Sequence mpayvfskesflkfleghleddvvvvvssdvtdfckklsesmvgekeycfaefafpadifdadedeide mmkyaivfvekeklseagrnair
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.25253
    Matthews' coefficent 2.19 Rfactor 0.19883
    Waters 27 Solvent Content 43.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fdo
    1. HKL-3000: the integration of data reduction and structure solution-from diffraction images to an initial model in minutes
    W Minor, M Cymborowski, Z Otwinowski - Section D: Biological , 2006 - scripts.iucr.org
     
    2. The crystal structure of the AF2331 protein from Archaeoglobus fulgidus DSM 4304 forms an unusual interdigitated dimer with a new type of _+ _ fold
    S Wang, O Kirillova, M Chruszcz, D Gront - Protein , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch