.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fbl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the hypothetical protein NE1496. To be Published
    Site MCSG
    PDB Id 2fbl Target Id APC5855
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS4874,NP_841537, 228410 Molecular Weight 17312.81 Da.
    Residues 151 Isoelectric Point 4.76
    Sequence mteierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksegglsrqeyeiqidvtq femlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflsedaaqafipppwfgeevted kryknkalalsip
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.28183
    Matthews' coefficent 2.84 Rfactor 0.21748
    Waters 296 Solvent Content 56.69

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 6

    Jmol

     
    Google Scholar output for 2fbl
    1. Structure and TBP binding of the Mediator head subcomplex Med8Med18Med20
    L Larivire, S Geiger, S Hoeppner, S Rther - Nature structural & , 2006 - nature.com
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Structural basis for the catalytic mechanism of mammalian 25-kDa thiamine triphosphatase
    J Song, L Bettendorff, M Tonelli, JL Markley - Journal of Biological , 2008 - ASBMB
     
    4. Novel triphosphate phosphohydrolase activity of Clostridium thermocellum TTM, a member of the triphosphate tunnel metalloenzyme superfamily
    N Keppetipola, R Jain, S Shuman - Journal of Biological Chemistry, 2007 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch