The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved Hypothetical Protein TM0937. To be Published
    Site MCSG
    PDB Id 2esh Target Id APC5794
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS4834,AAD36018, 243274 Molecular Weight 13778.19 Da.
    Residues 118 Isoelectric Point 8.07
    Sequence mrhrggrgfrgwwlastilllvaekpshgyelaerlaefgieipgighmgniyrvladleesgflstew dttvspprkiyritpqgklylreilrsledmkrrietleerikrvlqee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.27034
    Matthews' coefficent 3.07 Rfactor 0.2257
    Waters 40 Solvent Content 59.91

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Metals CA (CALCIUM) x 1


    Google Scholar output for 2esh
    1. Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition
    PK Madoori, H Agustiandari, AJM Driessen - The EMBO , 2008 - nature.com
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
    3. Top (Index), File: 19096365. pdf
    C Sensitive, PK Madoori - The EMBO , 2009 - www-tsujii.is.su-tokyo.ac.jp
    4. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch