The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Putative acetyltransferase from Agrobacterium tumefaciens str. C58. To be published
    Site MCSG
    PDB Id 2dxq Target Id APC5870
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4887,NP_532904.1, 176299 Molecular Weight 16134.58 Da.
    Residues 150 Isoelectric Point 6.83
    Sequence mssdaislraagpgdlpgllelyqvlnpsdpelttqeagavfaamlaqpgltifvatengkpvatatll ivpnltraarpyafienvvtlearrgrgygrtvvrhaietafgancykvmlltgrhdpavhafyescgf vqnktgfqirqd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.21697
    Matthews' coefficent 2.91 Rfactor 0.19532
    Waters 320 Solvent Content 57.78

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 8


    Google Scholar output for 2dxq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch