.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bb3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Cobalamin Biosynthesis Precorrin-6Y Methylase (cbiE) from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 2bb3 Target Id APC5543
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4683,AAB90520, 224325 Molecular Weight 22261.36 Da.
    Residues 197 Isoelectric Point 5.02
    Sequence miwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeirrimeegrerev avistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsevavvdchakdfdaeltellky rhlliladshfplerlgkrrvvllenlcmegeriregnadsielesdytiifverevme
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.27 Rfree 0.274
    Matthews' coefficent 2.24 Rfactor 0.211
    Waters 180 Solvent Content 45.03

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2bb3
    1. Prion and water: tight and dynamical hydration sites have a key role in structural stability
    A De Simone, GG Dodson, CS Verma - Proceedings of the , 2005 - National Acad Sciences
     
    2. Cloning, purification and preliminary crystallographic analysis of cobalamin methyltransferases from Rhodobacter capsulatus
    A Seyedarabi, T Hutchison, TT To, E Deery - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch