.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b3m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein AF1124 from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 2b3m Target Id APC5830
    Related PDB Ids 3k67 
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4864,AAB90117, 224325 Molecular Weight 17605.65 Da.
    Residues 159 Isoelectric Point 7.72
    Sequence mgggevkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdlnpvhfd edfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrvegvvsgveknryti dvkcytgdkvvaegvvkvliw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.20534
    Matthews' coefficent 3.40 Rfactor 0.17749
    Waters 117 Solvent Content 63.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b3m
    1. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch