.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b1y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical Protein from Agrobacterium tumefaciens reveals a new fold. To be Published
    Site MCSG
    PDB Id 2b1y Target Id APC5859
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4878,NP_532593, 176299 Molecular Weight 11641.82 Da.
    Residues 104 Isoelectric Point 9.69
    Sequence marpnfrythydlkelragttleislssvnnvrlmtganfqrftelldfkylggvakkspiriavpetm hwhliidaeghsglaessvkmlpaqpqatltrkas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.2207
    Matthews' coefficent 2.37 Rfactor 0.2125
    Waters 71 Solvent Content 47.71

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 2b1y
    1. The crystal structure of the AF2331 protein from Archaeoglobus fulgidus DSM 4304 forms an unusual interdigitated dimer with a new type of _+ _ fold
    S Wang, O Kirillova, M Chruszcz, D Gront - Protein , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch