.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b0c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.0A crystal structure of the putative phosphatase from Escherichia coli. To be Published
    Site MCSG
    PDB Id 2b0c Target Id APC5626
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4727,AAD13447.1, 83333 Molecular Weight 23545.56 Da.
    Residues 206 Isoelectric Point 5.41
    Sequence markeakmlyifdlgnvivdidfnrvlgawsdltriplaslkksfhmgeafhqhergeisdeafaealc hemalplsyeqfshgwqavfvalrpeviaimhklreqghrvvvlsntnrlhttfwpeeypeirdaadhi ylsqdlgmrkpeariyqhvlqaegfspsdtvffddnadnieganqlgitsilvkdkttipdyfakvlc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2588
    Matthews' coefficent 2.61 Rfactor 0.20058
    Waters 161 Solvent Content 52.00

    Ligand Information
    Ligands G1P (ALPHA-D-GLUCOSE-1-PHOSPHATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2b0c
    1. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    2. Activity-based functional annotation of unknown proteins: HAD-like hydrolases from E. coli and S. cerevisiae.
    E Kuznetsova - 2009 - 142.150.190.46
     
    3. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch