.
The Open Protein Structure Annotation Network
PDB Keyword
.

2av9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Function-biased choice of additives for optimization of protein crystallization - the case of the putative thioesterase PA5185 from Pseudomonas aeruginosa PAO1. Cryst.Growth Des. 8 4054-4061 2008
    Site MCSG
    PDB Id 2av9 Target Id APC5057
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4667,AAG08570, 208964 Molecular Weight 16462.74 Da.
    Residues 147 Isoelectric Point 6.06
    Sequence mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglvvsss cdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrssrpvaipqelrda laalqssaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.40 Rfree 0.25334
    Matthews' coefficent 2.23 Rfactor 0.20402
    Waters 59 Solvent Content 44.84

    Ligand Information
    Ligands SO4 (SULFATE) x 15
    Metals

    Jmol

     
    Google Scholar output for 2av9
    1. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    2. Function-Biased Choice of Additives for Optimization of Protein Crystallization: The Case of the Putative Thioesterase PA5185 from Pseudomonas aeruginosa PAO1
    M Chruszcz, MD Zimmerman, S Wang - Crystal Growth and , 2008 - ACS Publications
     
    3. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    FG Claudio, T Anatoli, B Greg, F Robert, E Elena - Biochemical , 2012 - biochemj.org
     
    4. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    CF Gonzalez, A Tchigvintsev, G Brown, R Flick - Biochemical , 2012 - 82.45.151.66
     
    5. Structure and activity of the {Less than} i {Greater than} Pseudomonas aeruginosa {Less than}/i {Greater than} hotdog-fold thioesterases PA5202 and PA2801
    C Gonzalez, A Tchigvintsev, G Brown, R Flick - 2012 - biochemj.org
     
    6. Structure of the putative thioesterase protein TTHA1846 from Thermus thermophilus HB8 complexed with coenzyme A and a zinc ion
    T Hosaka, K Murayama, M Kato-Murayama - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch