.
The Open Protein Structure Annotation Network
PDB Keyword
.

2arz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein from Pseudomonas aeruginosa. TO BE PUBLISHED
    Site MCSG
    PDB Id 2arz Target Id APC5551
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS4686,Q9HW16, 287 Molecular Weight 26999.22 Da.
    Residues 244 Isoelectric Point 5.93
    Sequence msveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqhthnlqadprcsm lvgergaediqavgrltllaearqlaeeevaaaaeryyryfpesadyhrvhdfdfwvlqpvqwrfiggf gaihwlaaervplanpfageaergmvehmnsdhaaaiahyvelaglpahaaaqlagidtegfhlrigqg lhwlpfpaacgnpgavrqalvqlaraerwptvepeqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24033
    Matthews' coefficent 2.60 Rfactor 0.19514
    Waters 317 Solvent Content 52.20

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 2arz
    1. M-TASSER: an algorithm for protein quaternary structure prediction
    H Chen, J Skolnick - Biophysical journal, 2008 - Elsevier
     
    2. Arabidopsis thaliana PGR7 encodes a conserved chloroplast protein that is necessary for efficient photosynthetic electron transport
    HS Jung, Y Okegawa, PM Shih, E Kellogg - PloS one, 2010 - dx.plos.org
     
    3. Refinement of protein termini in template_based modeling using conformational space annealing
    H Park, J Ko, K Joo, J Lee, C Seok - : Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch