.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a9s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of competence/damage inducible protein CihA from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2a9s Target Id APC5759
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4808,NP_532132, 176299 Molecular Weight 17631.19 Da.
    Residues 169 Isoelectric Point 6.91
    Sequence mslfpgdieelarriitdftplglmvstaesctggliagalteiagssavvdrgfvtytndakrdmlgv gtetlttfgavsrqtalqmahgalyrsranfavavtgiagpgggsaekpvglvhlatkarngnvlhhem rygdigrteirlatvrtalemlialnqagsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.21869
    Matthews' coefficent 1.80 Rfactor 0.16804
    Waters 273 Solvent Content 32.80

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 2a9s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch