.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a35

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A crystal structure of a hypothetical protein PA4017 from Pseudomonas aeruginosa PAO1. To be Published
    Site MCSG
    PDB Id 2a35 Target Id APC5820
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4857,AAG07404, 208964 Molecular Weight 23162.49 Da.
    Residues 213 Isoelectric Point 6.54
    Sequence mhstpkrvllagatgltgehlldrilseptlakviaparkalaehprldnpvgplaellpqldgsidta fcclgttikeagseeafravdfdlplavgkralemgarhylvvsalgadakssifynrvkgeleqalqe qgwpqltiarpsllfgpreefrlaeilaapiarilpgkyhgieacdlaralwrlaleegkgvrfvesde lrklgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.20395
    Matthews' coefficent 2.17 Rfactor 0.17423
    Waters 537 Solvent Content 43.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a35
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch