.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zx3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of hypothetical protein NE0241 from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 1zx3 Target Id APC5606
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS4717,NP_840335, 228410 Molecular Weight 11825.99 Da.
    Residues 98 Isoelectric Point 8.73
    Sequence mgkkknkktevqqpdpmrknwimenmdsgviylleswlkaksqetgkeisdifanavefnivlkdwgke kleetnteyqnqqrklrktyieyydremk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.26055
    Matthews' coefficent 2.20 Rfactor 0.21472
    Waters 4 Solvent Content 43.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zx3
    1. Performance of phased rotation, conformation and translation function: accurate protein model building with tripeptidic and tetrapeptidic fragments
    F Pavelcik, J Vaclavik - Acta Crystallographica Section D: Biological , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch