.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z7a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of probable Polysaccharide deacetylase from Pseudomonas aeruginosa PAO1. To be Published
    Site MCSG
    PDB Id 1z7a Target Id APC5597
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4708,AAG04906, 208964 Molecular Weight 35662.38 Da.
    Residues 308 Isoelectric Point 5.54
    Sequence msadyprdligygnnpphphwpgdarialsfvlnyeeggercvlhgdkeseaflsemvaaqplqgvrhm smeslyeygsragvwrllklfkrrnvpltvfavamaaqrnpeviramvadgheicshgyrwidyqymde aqerehmleairilteltgqrpvgwytgrtgpntrrlvmeeggflydsdtydddlpywdpastaekphl vipytldtndmrftqvqgfnngeqffqylkdafdvlyeegatapkmlsiglhcrligrparmaalerfi qyaqshdkvwfarrediarhwhrehpfqetea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.71 Rfree 0.17461
    Matthews' coefficent 2.70 Rfactor 0.15105
    Waters 2141 Solvent Content 53.50

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 19;GOL (GLYCEROL) x 7;IPA (ISOPROPYL) x 8
    Metals

    Jmol

     
    Google Scholar output for 1z7a
    1. Evaluation of features for catalytic residue prediction in novel folds
    E Youn, B Peters, P Radivojac, SD Mooney - Protein science, 2007 - Wiley Online Library
     
    2. Structure and activity of two metal ion-dependent acetylxylan esterases involved in plant cell wall degradation reveals a close similarity to peptidoglycan deacetylases
    EJ Taylor, TM Gloster, JP Turkenburg, F Vincent - Journal of Biological , 2006 - ASBMB
     
    3. Crystal structure of the YdjC-family protein TTHB029 from Thermus thermophilus HB8: Structural relationship with peptidoglycan N-acetylglucosamine deacetylase
    T Imagawa, H Iino, M Kanagawa, A Ebihara - Biochemical and , 2008 - Elsevier
     
    4. The Structure of Helicobacter pylori HP0310 Reveals an Atypical Peptidoglycan Deacetylase
    MM Shaik, L Cendron, R Percudani, G Zanotti - PloS one, 2011 - dx.plos.org
     
    5. Structure of a carbohydrate esterase from Bacillus anthracis
    L Oberbarnscheidt, EJ Taylor - Proteins: Structure, , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch