.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yxo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of pyridoxal phosphate biosynthetic protein PdxA PA0593. To be Published
    Site MCSG
    PDB Id 1yxo Target Id APC5538
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4679,AAG03982, 208964 Molecular Weight 34921.29 Da.
    Residues 328 Isoelectric Point 6.15
    Sequence mslrfaltpgepagigpdlclllarsaqphpliaiasrtllqeragqlglaidlkdvspaawperpaka gqlyvwdtplaapvrpgqldranaayvletltragqgcldghfagmitapvhkgvineagipfsghtef ladlthtaqvvmmlatrglrvalatthlplrevadaisderltrvarilhadlrdkfgiahprilvcgl nphagegghlgreeieviepclerlrgegldligplpadtlftpkhlehcdavlamyhdqglpvlkykg fgaavnvtlglpiirtsvdhgtaldlagsgridsgslqvaletayqmaasrc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.243
    Matthews' coefficent 2.29 Rfactor 0.198
    Waters 450 Solvent Content 45.95

    Ligand Information
    Ligands EOH (ETHANOL) x 10
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 1yxo
    1. Coenzyme biosynthesis: enzyme mechanism, structure and inhibition
    DE Scott, A Ciulli, C Abell - Natural product reports, 2007 - pubs.rsc.org
     
    2. Investigating terephthalate biodegradation: Structural characterization of a putative decarboxylating cis-dihydrodiol dehydrogenase
    J Bains, JE Wulff, MJ Boulanger - Journal of Molecular Biology, 2012 - Elsevier
     
    3. Applications of Structural Bioinformatics for the Structural Genomics Era
    M Novotny - 2007 - uu.diva-portal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch