.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yx2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1yx2 Target Id APC1509
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4542,P54378, 1423 Molecular Weight 39777.21 Da.
    Residues 362 Isoelectric Point 5.81
    Sequence mlkrtplfdlykeyggktidfggwelpvqfssikkeheavrtaaglfdvshmgevevsgndslsflqrl mtndvsaltpgraqytamcypdggtvddlliyqkgenryllvinasnidkdlawmkehaagdvqidnqs dqiallavqgpkaeailknltdadvsalkpfafideadisgrkalisrtgytgedgyeiycrsddamhi wkkiidagdayglipcglgardtlrfeanvplygqeltrditpieagigfavkhkkesdffgksvlseq kengakrklvglemiekgiprhgyevfqngksvgkvttgtqsptlgknvglalidsetseigtvvdvei rkklvkakvvktpfykr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.08 Rfree 0.28797
    Matthews' coefficent 2.30 Rfactor 0.21165
    Waters 524 Solvent Content 46.40

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1yx2
    1. Structures of dimethylsulfoniopropionate_dependent demethylase from the marine organism Pelagabacter ubique
    DJ Schuller, CR Reisch, MA Moran - Protein , 2012 - Wiley Online Library
     
    2. How do thermophilic proteins resist aggregation?
    AM Thangakani, S Kumar - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch