.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yqe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved Hypothetical Protein AF0625. To be Published
    Site MCSG
    PDB Id 1yqe Target Id APC5611
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4721,AAB90614, 224325 Molecular Weight 31456.07 Da.
    Residues 278 Isoelectric Point 5.33
    Sequence mklvvcsesdtagqnikdnlltfadfeekdvgefklylsdefyiaetkerliyadhideklakyidfee ilfasrhsskdgrkiftvhvsgnvgtadfggkpyslakpspqtmknyvlalrerldrkpefeftmevth hgpseiskpsafyeigsteeewkdreaaevvaeamldairaekmdwnvavgvggthyaprqteimlttt ftfghnfakytfehltaeflvkavklseaeyiiideksvnsavkkivneaaevagvevlkskkvkkdfrlv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.83 Rfree 0.23
    Matthews' coefficent 2.08 Rfactor 0.206
    Waters 213 Solvent Content 40.31

    Ligand Information
    Ligands POP (PYROPHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1yqe
    1. Widespread distribution of cell defense against D-aminoacyl-tRNAs
    S Wydau, G Van der Rest, C Aubard, P Plateau - Journal of Biological , 2009 - ASBMB
     
    2. Coulomb energies of protein-protein complexes with monopole-free charge distributions
    M Das, G Basu - Journal of Molecular Graphics and Modelling, 2009 - Elsevier
     
    3. Cartographie structurale et fonctionnelle de la liaison entre la peptidyl-ARNt hydrolase et son substrat
    G Laurent - 2010 - hal-polytechnique.archives-ouvertes
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch