.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yoy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of predicted coding region AF1432 from Archaeoglobus Fulgidus. To be Published
    Site MCSG
    PDB Id 1yoy Target Id APC5600
    Related PDB Ids 1ynb 
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS4712,G69428, 2234 Molecular Weight 19790.69 Da.
    Residues 173 Isoelectric Point 5.78
    Sequence mciikpmddvvkfihevgslkltprsgwlklgirlpesvaehsfraaiiafilalksgesvekackaat aalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadklelafqgveysqq vsyairfaenvelktdaakeiyrvlmerknpvwwr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.23589
    Matthews' coefficent 2.40 Rfactor 0.18362
    Waters 79 Solvent Content 49.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yoy
    1. Diversity of structure and function of response regulator output domains
    MY Galperin - Current opinion in microbiology, 2010 - Elsevier
     
    2. VV prasanth & S. Chitti: Predicting the function of a hypothetical protein from Pyrococcus horikoshii OT3 as HD domain containing metal-dependent
    PA Babu, K Harshita - The Internet Journal of Genomics and Proteomics, 2010 - ispub.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1ynb.png
    No description
    35.24 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch