.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yox

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of the conserved hypothetical protein PA3696. To be Published
    Site MCSG
    PDB Id 1yox Target Id APC5602
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4714,NP_252386, 208964 Molecular Weight 26549.76 Da.
    Residues 248 Isoelectric Point 5.44
    Sequence masheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllgklwsagkrklg gesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgagf fggegfilqklegdglvfvhaggtlirrqlngetlrvdtgclvaftdgidydvqlagglksmlfggegl llttlkgsgtvwlqslpfsrlagriydatfrareevrtnng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.27896
    Matthews' coefficent 2.53 Rfactor 0.22455
    Waters 235 Solvent Content 50.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yox
    1. Recent Advances in Structure-Based Design of Nuclear Hormone Receptors
    RL Magolda, WS Somers - Frontiers in Drug Design , 2007 - ingentaconnect.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch