.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yoc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of genomics AFPA1835 by Sulfur SAD methods. To be Published
    Site MCSG
    PDB Id 1yoc Target Id APC5556
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4689,NP_250526, 208964 Molecular Weight 15793.36 Da.
    Residues 145 Isoelectric Point 5.84
    Sequence msqmmqmyqqvgpaqfsamigqfapyfasiapqfvelrpgyaevtfpkrrevlnhigtvhaialcnaae laagtmtdasipaghrwiprgmtveylakatgdvravadgsqidwqatgnlvvpvvayvddkpvfraei tmyvsqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.2
    Matthews' coefficent 2.31 Rfactor 0.167
    Waters 362 Solvent Content 46.33

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1yoc
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Crystal structure of human thioesterase superfamily member 2
    Z Cheng, F Song, X Shan, Z Wei, Y Wang - Biochemical and , 2006 - Elsevier
     
    3. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    4. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    FG Claudio, T Anatoli, B Greg, F Robert, E Elena - Biochemical , 2012 - biochemj.org
     
    5. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    CF Gonzalez, A Tchigvintsev, G Brown, R Flick - Biochemical , 2012 - 82.45.151.66
     
    6. Structure and activity of the {Less than} i {Greater than} Pseudomonas aeruginosa {Less than}/i {Greater than} hotdog-fold thioesterases PA5202 and PA2801
    C Gonzalez, A Tchigvintsev, G Brown, R Flick - 2012 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch