.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yll

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Conserved Hypothetical Protein PA5104 from Pseudomonas aeruginosa PAO1. To be Published
    Site MCSG
    PDB Id 1yll Target Id APC5581
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4703,AAG08489.1, 208964 Molecular Weight 21413.94 Da.
    Residues 196 Isoelectric Point 5.48
    Sequence mselrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfagyqriisvlegg gmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarlqwlrvegeldwhgtas tlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrltahepawvcaveldsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.64 Rfree 0.24328
    Matthews' coefficent 2.00 Rfactor 0.19409
    Waters 773 Solvent Content 39.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yll
    1. Genetic analysis of the histidine utilization (hut) genes in Pseudomonas fluorescens SBW25
    XX Zhang, PB Rainey - Genetics, 2007 - Genetics Soc America
     
    2. Structural and biochemical analysis of HutD from Pseudomonas fluorescens SBW25: a thesis submitted in fulfilment of the requirements for the degree of Master of
    Y Liu - 2009 - muir.massey.ac.nz
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch