.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y7p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.9A crystal structure of a hypothetical protein AF1403 from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 1y7p Target Id APC5042
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS4652,O28869, 2234 Molecular Weight 24036.65 Da.
    Residues 219 Isoelectric Point 5.67
    Sequence mlrglriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdfekilervktfd yiieieeeesfervfgkrviilgggalvsqvaigaiseadrhnlrgerisvdtmpvvgeeeiaeavkav srlhraevlvlaggimggkiteevkklrksgirvislsmfgsvpdvadvvisdpvmagtlavmhiseka kfdldrvkgrri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.255
    Matthews' coefficent 1.96 Rfactor 0.211
    Waters 234 Solvent Content 35.00

    Ligand Information
    Ligands RIP (RIBOSE(PYRANOSE) x 3
    Metals ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 1y7p
    1. Optimal description of a protein structure in terms of multiple groups undergoing TLS motion
    J Painter, EA Merritt - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Detection of protein assemblies in crystals
    E Krissinel, K Henrick - Computational Life Sciences, 2005 - Springer
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Solution structure of hypothetical protein, HP0495 (Y495_HELPY) from Helicobacter pylori
    MD Seo, SJ Park, HJ Kim, BJ Lee - Proteins: Structure, Function , 2007 - Wiley Online Library
     
    5. Structural Analysis of Hypothetical Proteins from Helicobacter pylori: An Approach to Estimate Functions of Unknown or Hypothetical Proteins
    SJ Park, WS Son, BJ Lee - International Journal of Molecular Sciences, 2012 - mdpi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch