.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y0u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 1y0u Target Id APC5036
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS4647,AAB91060, 2234 Molecular Weight 10825.97 Da.
    Residues 92 Isoelectric Point 8.71
    Sequence msleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkqldyhlkvleagf ciervgerwvvtdagkivdkirg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.20144
    Matthews' coefficent 1.96 Rfactor 0.17172
    Waters 263 Solvent Content 36.90

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1y0u
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch