The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein PA3463 from Pseudomonas aeruginosa strain PAO1. To be Published
    Site MCSG
    PDB Id 1y0n Target Id APC5056
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4666,AAG06851, 208964 Molecular Weight 8697.29 Da.
    Residues 76 Isoelectric Point 4.48
    Sequence mliphdlleadtlnnlledfvtregtdngdetpldvrverarhalrrgeavilfdpesqqcqlmlrsev paellrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.28893
    Matthews' coefficent 2.81 Rfactor 0.24565
    Waters 28 Solvent Content 56.26

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;GOL-GOL (GLYCEROL) x 1


    Google Scholar output for 1y0n

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch