.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y0k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.75 A Crystal Structure of the Hypothetical Protein Pa4535 from Pseudomonas Aeruginosa. To be Published
    Site MCSG
    PDB Id 1y0k Target Id APC5555
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4688,NP_253225, 208964 Molecular Weight 24234.24 Da.
    Residues 209 Isoelectric Point 9.24
    Sequence mneadylrlltrqaeqandflsnarkwdrerwvcqrflealnvpyrqedfaapgeqppdvlfkgagfev ffvldegrrlneewreeltrrrqavslrqlirreerpqriaaaelqarlaptlrkkahnysergidhge ldllafvnlkravpdfntpfpppteylrqgwrslsmvgptfarvlfahsgapeflranlgrsilfdagvgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.222
    Matthews' coefficent 2.09 Rfactor 0.186
    Waters 191 Solvent Content 0.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1y0k
    1. Sequence, structure and functional diversity of PD-(D/E) XK phosphodiesterase superfamily
    K Steczkiewicz, A Muszewska, L Knizewski - Nucleic Acids , 2012 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch