.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xvh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Staphylococcus aureus hypothetical protein (NP_646141.1, domain 3912-4037) similar to streptococcal adhesins emb and ebhA/ebhB. TO BE PUBLISHED
    Site MCSG
    PDB Id 1xvh Target Id APC298
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mw2
    Alias Ids TPS4468,APC298, 196620 Molecular Weight 13557.02 Da.
    Residues 129 Isoelectric Point 7.96
    Sequence tstmgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilnkqtgpntaktaveqalnnvnnak halngtqnlnnakqaaitaingasdlnqkqkdalkaqangaqrvsnaqdvqhnatelnta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24382
    Matthews' coefficent 2.40 Rfactor 0.21176
    Waters 207 Solvent Content 49.40

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals ZN (ZINC) x 16

    Jmol

     
    Google Scholar output for 1xvh
    1. A Helical String of Alternately Connected Three-Helix Bundles for the Cell Wall-Associated Adhesion Protein Ebh from Staphylococcus aureus
    Y Tanaka, S Sakamoto, M Kuroda, S Goda, YG Gao - Structure, 2008 - Elsevier
     
    2. Thin-layer spectroelectrochemistry of the Fe (III)/Fe (II) redox reaction of dehaloperoxidase-hemoglobin
    EL D'Antonio, EF Bowden, S Franzen - Journal of Electroanalytical , 2012 - Elsevier
     
    3. Dynamic features of homo_dimer interfaces calculated by normal mode analysis
    Y Tsuchiya, K Kinoshita, S Endo, H Wako - Protein Science, 2012 - Wiley Online Library
     
    4. Investigation of the structure and function of type III secretion needle and tip proteins
    L Zhang - 2009 - kuscholarworks.ku.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch