.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xdz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.6A crystal ctructure of Gram-positive Bacillus subtilis glucose inhibited division protein B (gidB). To be Published
    Site MCSG
    PDB Id 1xdz Target Id APC1859
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4571,P25813, 1423 Molecular Weight 26952.57 Da.
    Residues 239 Isoelectric Point 6.54
    Sequence mnieeftsglaekgislsprqleqfelyydmlvewnekinltsitekkevylkhfydsitaafyvdfnq vnticdvgagagfpslpikicfphlhvtivdslnkritfleklsealqlenttfchdraetfgqrkdvr esydivtaravarlsvlselclplvkknglfvalkaasaeeelnagkkaittlggelenihsfklpiee sdrnimvirkikntpkkyprkpgtpnkspieg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.22052
    Matthews' coefficent 2.04 Rfactor 0.20207
    Waters 211 Solvent Content 37.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xdz
    1. Structural and functional studies of the Thermus thermophilus 16S rRNA methyltransferase RsmG
    ST Gregory, H Demirci, R Belardinelli, T Monshupanee - RNA, 2009 - rnajournal.cshlp.org
     
    2. A score of the ability of a three-dimensional protein model to retrieve its own sequence as a quantitative measure of its quality and appropriateness
    LP Martnez-Castilla, R Rodrguez-Sotres - PloS one, 2010 - dx.plos.org
     
    3. Refinement of protein termini in template_based modeling using conformational space annealing
    H Park, J Ko, K Joo, J Lee, C Seok - : Structure, Function, and , 2011 - Wiley Online Library
     
    4. Regulation of expression and catalytic activity of Escherichia coli RsmG methyltransferase
    A Bentez-Pez, M Villarroya, ME Armengod - RNA, 2012 - rnajournal.cshlp.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch